Browsing Modes for Business Users

Ipilimumab antibody | AbD34294

Human anti Ipilimumab (Drug/Target Complex)

Product Type
Monoclonal Antibody
Clone
AbD34294
Isotype
HuCAL Fab monovalent
Specificity
Ipilimumab

Product Code Applications Pack Size List Price Your Price Qty
HCA331
Datasheet Datasheet Datasheet
SDS Safety Datasheet SDS
E 0.1 mg loader
List Price Your Price
loader

Human Anti-Ipilimumab Antibody, clone AbD34294 specifically recognizes the monoclonal antibody drug ipilimumab when in complex with its target, CTLA-4 (cytotoxic T-lymphocyte antigen-4). The antibody does not recognize free ipilimumab or unbound recombinant human CTLA-4. It can be used to measure levels of ipilimumab in patient samples.

Clone AbD34294 is a monovalent Fab format antibody that can be used to develop a pharmacokinetic (PK) antigen capture assay to measure free ipilimumab captured via immobilized CTLA-4.

Ipilimumab (Yervoy) is a human IgG1/kappa antibody developed from a transgenic mouse. It has been approved by the FDA for the treatment of metastatic melanoma, renal cell carcinoma, and in combination with nivolumab for the treatment of previously treated microsatellite instability-high/deficient mismatch repair (MSI-H/dMMR) metastatic colorectal cancer. Ipilimumab activates the immune system by targeting CTLA-4, a protein receptor that downregulates the immune system. The action of cytotoxic T lymphocytes (CTLs) to recognize and destroy cancer cells is subject to an inhibitory mechanism that interrupts this destruction. Ipilimumab turns off this inhibitory mechanism and allows CTLs to function.

View a summary of all anti-ipilimumab antibodies
20th Anniversary

Product Form
A monovalent human recombinant Fab (lambda light chain) selected from the HuCAL phage display library, expressed in E. coli. The antibody is tagged with a DYKDDDDK tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK). This antibody is supplied as a liquid.
Preparation
StrepTactin affinity chromatography
Source
E.coli
Buffer Solution
Phosphate buffered saline
Preservative Stabilisers
0.09% Sodium Azide (NaN3)
Immunogen
Ipilimumab/CTLA-4 complex
Affinity
The intrinsic affinity of the monovalent form of Human anti Ipilimumab antibody, clone AbD34294 is KD = 252 nM as measured by real time, label free molecular interaction analysis on immobilized CTLA-4/ipilimumab complex.
Approx. Protein Concentrations
Antibody concentration 0.5 mg/ml
Regulatory
For research purposes only
Guarantee
12 months from date of despatch
Acknowledgements
This product and/or its use is covered by claims of U.S. patents, and/or pending U.S. and non-U.S. patent applications owned by or under license to Bio-Rad Laboratories, Inc. See bio-rad.com/en-us/trademarks for details.
Yervoy is a trademark of Bristol-Myers Squibb Company.
Licensed Use
For in vitro research purposes and for commercial applications for the provision of in vitro testing services to support preclinical and clinical drug development. Any re-sale in any form or any other commercial application needs a written agreement with Bio-Rad.

This product is shipped at ambient temperature. It is recommended to aliquot and store at -20°C on receipt. When thawed, aliquot the sample as needed. Keep aliquots at 2-8°C for short term use (up to 4 weeks) and store the remaining aliquots at -20°C.

Avoid repeated freezing and thawing as this may denature the antibody. Storage in frost-free freezers is not recommended.

This product has been reported to work in the following applications. This information is derived from testing within our laboratories, peer-reviewed publications or personal communications from the originators. Please refer to references indicated for further information. For general protocol recommendations, please visit the antibody protocols page.
Application Name Verified Min Dilution Max Dilution
ELISA
Where this product has not been tested for use in a particular technique this does not necessarily exclude its use in such procedures. Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own system using appropriate negative/positive controls.
Technical Advice
Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual.

This antibody contains a Strep-tag and will react with streptavidin.
Clone AbD34294 is also available in the SpyTagged monovalent Fab format that doesn't contain any Strep-Tag under product code TZA001.
ELISA
Human anti Ipilimumab (drug/target complex) antibody, clone AbD34294 is recommended for use as the detection reagent in an antigen capture assay to measure free Ipilimumab captured via immobilized CTLA-4.

Protocol: PK antigen capture ELISA to measure bound drug exclusively.

Description Product Code Applications Pack Size List Price Your Price Quantity
Rat anti DYKDDDDK Tag:HRP MCA4764P E P WB 0.1 mg loader
List Price Your Price
loader
Description Rat anti DYKDDDDK Tag:HRP

Description Product Code Applications Pack Size List Price Your Price Quantity
Hispec Assay Diluent BUF049A E IY 50 ml
List Price Your Price
Description Hispec Assay Diluent
Human anti Ipilimumab HCA327 E 0.1 mg loader
List Price Your Price
loader
Description Human anti Ipilimumab
Human anti Ipilimumab HCA328 E 0.1 mg loader
List Price Your Price
loader
Description Human anti Ipilimumab
Human anti Ipilimumab HCA329 E 0.1 mg loader
List Price Your Price
loader
Description Human anti Ipilimumab
Human anti Ipilimumab HCA330 E 0.1 mg loader
List Price Your Price
loader
Description Human anti Ipilimumab
LYNX Rapid HRP Antibody Conjugation Kit LNK002P CJ 3 Conjugations For 400µg Antibody
List Price Your Price
Description LYNX Rapid HRP Antibody Conjugation Kit
Human anti Ipilimumab (Drug/Target Complex) TZA001 E 0.1 mg
List Price Your Price
Description Human anti Ipilimumab (Drug/Target Complex)
Human anti Ipilimumab (Drug/Target Complex):HRP TZA001P E 0.1 mg
List Price Your Price
Description Human anti Ipilimumab (Drug/Target Complex):HRP

Synonyms
Yervoy

HCA331

153339 160508 164793

If you cannot find the batch/lot you are looking for please contact our technical support team for assistance.

View more products with IPILIMUMAB specificity

Please Note: All Products are "FOR RESEARCH PURPOSES ONLY"

Please note