Ipilimumab antibody | AbD34433
Human anti Ipilimumab
- Product Type
- Monoclonal Antibody
- Clone
- AbD34433
- Isotype
- HuCAL Fab monovalent
- Specificity
- Ipilimumab
Human Anti-Ipilimumab Antibody, clone AbD34433 is a paratope specific, inhibitory anti-idiotypic antibody that specifically recognizes the monoclonal antibody ipilimumab. It does not recognize free human CTLA-4 (cytotoxic T-lymphocyte antigen-4) or ipilimumab in complex with CTLA-4. The antibody can be used to measure free ipilimumab in patient samples. A pair of anti-ipilimumab antibodies can be used to develop a pharmacokinetic (PK) bridging assay to measure free drug. This antibody, in monovalent Fab format, is recommended as the capture antibody, paired with an HRP conjugated Anti-Ipilimumab Antibody in full immunoglobulin format, clone AbD34429ia (HCA329P) as the detection antibody. Ipilimumab (Yervoy) is a human IgG1/kappa antibody developed from a transgenic mouse. It has been approved by the FDA for the treatment of metastatic melanoma, renal cell carcinoma, and in combination with nivolumab for the treatment of previously treated microsatellite instability-high/deficient mismatch repair (MSI-H/dMMR) metastatic colorectal cancer. Ipilimumab activates the immune system by targeting CTLA-4, a protein receptor that downregulates the immune system. The action of cytotoxic T lymphocytes (CTLs) to recognize and destroy cancer cells is subject to an inhibitory mechanism that interrupts this destruction. Ipilimumab turns off this inhibitory mechanism and allows CTLs to function. View a summary of all anti-ipilimumab antibodies |
- Product Form
- A monovalent human recombinant Fab (kappa light chain) selected from the HuCAL phage display library, expressed in E. coli. The antibody is tagged with a DYKDDDDK tag and a double extended Strep-tag (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEK). This antibody is supplied liquid.
- Preparation
- StrepTactin affinity chromatography
- Source
- E.coli
- Buffer Solution
- Phosphate buffered saline
- Preservative Stabilisers
- 0.09% Sodium Azide (NaN3)
- Immunogen
- Ipilimumab
- Affinity
- The intrinsic affinity of the monovalent form of Human anti Ipilimumab antibody, clone AbD34433 is KD = 0.3 nM as measured by real time, label free molecular interaction analysis on immobilized Ipilimumab.
- Approx. Protein Concentrations
- Antibody concentration 0.5 mg/ml
- Regulatory
- For research purposes only
- Guarantee
- 12 months from date of despatch
- Acknowledgements
- This product and/or its use is covered by claims of U.S. patents, and/or pending U.S. and non-U.S. patent applications owned by or under license to Bio-Rad Laboratories, Inc. See bio-rad.com/en-us/trademarks for details.
Yervoy is a trademark of Bristol-Myers Squibb Company. - Licensed Use
- For in vitro research purposes and for commercial applications for the provision of in vitro testing services to support preclinical and clinical drug development. Any re-sale in any form or any other commercial application needs a written agreement with Bio-Rad.
Avoid repeated freezing and thawing as this may denature the antibody. Storage in frost-free freezers is not recommended.
Application Name | Verified | Min Dilution | Max Dilution |
---|---|---|---|
ELISA |
- Technical Advice
- Recommended protocols and further information about HuCAL recombinant antibody technology can be found in the HuCAL Antibodies Technical Manual.
This antibody contains Strep-tag and will react with streptavidin. - ELISA
- Human anti Ipilimumab antibody, clone AbD34433 can be used in an indirect ELISA or as a capture antibody in a sandwich ELISA together with HCA329P as the detection reagent.
Protocol: PK bridging ELISA.
Description | Product Code | Applications | Pack Size | List Price | Your Price | Quantity | |
---|---|---|---|---|---|---|---|
Rat anti DYKDDDDK Tag:HRP | MCA4764P | E P WB | 0.1 mg | Log in | |||
List Price | Your Price | ||||||
Log in | |||||||
Description | Rat anti DYKDDDDK Tag:HRP |
Description | Product Code | Applications | Pack Size | List Price | Your Price | Quantity | |
---|---|---|---|---|---|---|---|
Hispec Assay Diluent | BUF049A | E IY | 50 ml | Log in | |||
List Price | Your Price | ||||||
Log in | |||||||
Description | Hispec Assay Diluent | ||||||
Human anti Ipilimumab | HCA327 | E | 0.1 mg | Log in | |||
List Price | Your Price | ||||||
Log in | |||||||
Description | Human anti Ipilimumab | ||||||
Human anti Ipilimumab | HCA328 | E | 0.1 mg | Log in | |||
List Price | Your Price | ||||||
Log in | |||||||
Description | Human anti Ipilimumab | ||||||
Human anti Ipilimumab | HCA329 | E | 0.1 mg | Log in | |||
List Price | Your Price | ||||||
Log in | |||||||
Description | Human anti Ipilimumab | ||||||
Human anti Ipilimumab (Drug/Target Complex) | HCA331 | E | 0.1 mg | Log in | |||
List Price | Your Price | ||||||
Log in | |||||||
Description | Human anti Ipilimumab (Drug/Target Complex) | ||||||
LYNX Rapid HRP Antibody Conjugation Kit | LNK002P | CJ | 3 Conjugations For 400µg Antibody | Log in | |||
List Price | Your Price | ||||||
Log in | |||||||
Description | LYNX Rapid HRP Antibody Conjugation Kit |
- Synonyms
- Yervoy
HCA330
153338If you cannot find the batch/lot you are looking for please contact our technical support team for assistance.
Please Note: All Products are "FOR RESEARCH PURPOSES ONLY"
Always be the first to know.
When we launch new products and resources to help you achieve more in the lab.
Yes, sign me up